PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155350001
Common NameGSBRNA2T00155350001, LOC106385167
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 310aa    MW: 33150.2 Da    PI: 8.9908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155350001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3977136362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n++++
  GSBRNA2T00155350001  77 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTK 136
                          6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3560129IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47880134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MIFSSIQAYL DSSNWQQAPP SNYNQGGEGA SATGGHGLGP QLQPQSQPQP NGSGSSGSIR  60
PGSMVDRARH ANVAIPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKTC RRYWTRGGAL  120
RNVPVGGGCR RNRRTKSSNN NNNSTATSNN TSFSSAASGN ASTISAILSS NYGGNQESFL  180
SQILSPVRLM NTTYTTDNNM SLLNCGGLNQ DLRSIQMGNS GGSLMSCVDE WRSTSHHQQP  240
QSLGGGNCEA SSNTNPSSNG FYPFESPRIT SALASQFSSV KVEDNPYKWV NVNGNCSSWT  300
DLSTFGSSR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120133RNVPVGGGCRRNRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155350001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893070.0AC189307.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB033O04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634080.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_013680574.10.0PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-155DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078DVI20.0A0A078DVI2_BRANA; BnaC04g45310D protein
TrEMBLA0A0D3C4U00.0A0A0D3C4U0_BRAOL; Uncharacterized protein
STRINGBra017171.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-136DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]